APOM monoclonal antibody (M03), clone 1G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant APOM.
Immunogen
APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APOM is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — APOM
Entrez GeneID
55937GeneBank Accession#
BC020683Protein Accession#
AAH20683Gene Name
APOM
Gene Alias
G3a, HSPC336, MGC22400, NG20
Gene Description
apolipoprotein M
Omim ID
606907Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized. [provided by RefSeq
Other Designations
NG20-like protein|OTTHUMP00000029364|alternative name: G3a, NG20
-
Interactome
-
Disease
-
Publication Reference
-
Circulating cord blood HDL-S1P complex preserves the integrity of the feto-placental vasculature.
Del Gaudio I, Sreckovic I, Zardoya-Laguardia P, Bernhart E, Christoffersen C, Frank S, Marsche G, Illanes SE, Wadsack C.
Biochimica et Biophysica Acta. Molecular and Cell Biology of Lipids 2020 Apr; 1865(4):158632.
Application:Cap Ab, ELISA, Human, Cord plasma.
-
Apolipoprotein M: a novel adipokine decreasing with obesity and upregulated by calorie restriction.
Sramkova V, Berend S, Siklova M, Caspar-Bauguil S, Carayol J, Bonnel S, Marques M, Decaunes P, Kolditz CI, Dahlman I, Arner P, Stich V, Saris WHM, Astrup A, Valsesia A, Rossmeislova L, Langin D, Viguerie N.
The American Journal of Clinical Nutrition 2019 Jun; 109(6):1499.
Application:WB, Human, Adipose tissue.
-
Protein Unfolding allow use of Commercial Antibodies in an Apolipoprotein M sandwich ELISA.
Bosteen MH, Dahlback B, Nielsen LB, Christoffersen C.
Journal of Lipid Research 2015 Mar; 56(3):754.
Application:S-ELISA, Human, Plasma.
-
Circulating cord blood HDL-S1P complex preserves the integrity of the feto-placental vasculature.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com