APOM monoclonal antibody (M01), clone 1F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of APOM expression in transfected 293T cell line by APOM monoclonal antibody (M01), clone 1F10.
Lane 1: APOM transfected lysate(21.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APOM is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of APOM over-expressed 293 cell line, cotransfected with APOM Validated Chimera RNAi ( Cat # H00055937-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with APOM monoclonal antibody (M01), clone 1F10 (Cat # H00055937-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant APOM.
Immunogen
APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
Host
Mouse
Reactivity
Human
Isotype
IgG1
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of APOM expression in transfected 293T cell line by APOM monoclonal antibody (M01), clone 1F10.
Lane 1: APOM transfected lysate(21.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APOM is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of APOM over-expressed 293 cell line, cotransfected with APOM Validated Chimera RNAi ( Cat # H00055937-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with APOM monoclonal antibody (M01), clone 1F10 (Cat # H00055937-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — APOM
Entrez GeneID
55937GeneBank Accession#
BC020683Protein Accession#
AAH20683Gene Name
APOM
Gene Alias
G3a, HSPC336, MGC22400, NG20
Gene Description
apolipoprotein M
Omim ID
606907Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized. [provided by RefSeq
Other Designations
NG20-like protein|OTTHUMP00000029364|alternative name: G3a, NG20
-
Interactome
-
Disease
-
Publication Reference
-
17β-estradiol regulates the expression of apolipoprotein M through estrogen receptor α-specific binding motif in its promoter.
Wei J, Yu Y, Luo GH, Feng YH, Shi YP, Zhang J, Mu QF, Yu MM, Pan LL, Berggren-Söderlund M, Nilsson-Ehle P, Zhang XY, Xu N.
Lipids in Health and Disease 2017 Mar; 16(1):66.
Application：WB-Ce, Human, HepG2 cells.
-
Effects of simvastatin on apolipoprotein M in vivo and in vitro.
Zhang X, Mao S, Luo G, Wei J, Berggren-Soderlund M, Nilsson-Ehle P, Xu N.
Lipids in Health and Disease 2011 Jul; 10:112.
Application：Dot, Mouse, Serum.
-
Liver X receptor agonist downregulates hepatic apoM expression in vivo and in vitro.
Zhang X, Zhu Z, Luo G, Zheng L, Nilsson-Ehle P, Xu N.
Biochemical and Biophysical Research Communications 2008 Apr; 371(1):114.
Application：Dot, Mouse, Mouse serum.
-
17β-estradiol regulates the expression of apolipoprotein M through estrogen receptor α-specific binding motif in its promoter.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com