TMEM126B MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TMEM126B MaxPab rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in human kidney.
Western Blot (Tissue lysate)
TMEM126B MaxPab rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in mouse spleen.
Western Blot (Transfected lysate)
Western Blot analysis of TMEM126B expression in transfected 293T cell line (H00055863-T01) by TMEM126B MaxPab polyclonal antibody.
Lane 1: TMEM126B transfected lysate(22.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TMEM126B transfected lysate using anti-TMEM126B MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TMEM126B MaxPab rabbit polyclonal antibody (D01) (H00055863-D01).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TMEM126B protein.
Immunogen
TMEM126B (NP_060950.2, 1 a.a. ~ 200 a.a) full-length human protein.
Sequence
MAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (59); Rat (59)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TMEM126B MaxPab rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in human kidney.Western Blot (Tissue lysate)
TMEM126B MaxPab rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in mouse spleen.Western Blot (Transfected lysate)
Western Blot analysis of TMEM126B expression in transfected 293T cell line (H00055863-T01) by TMEM126B MaxPab polyclonal antibody.
Lane 1: TMEM126B transfected lysate(22.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TMEM126B transfected lysate using anti-TMEM126B MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TMEM126B MaxPab rabbit polyclonal antibody (D01) (H00055863-D01). -
Gene Info — TMEM126B
Entrez GeneID
55863GeneBank Accession#
NM_018480Protein Accession#
NP_060950.2Gene Name
TMEM126B
Gene Alias
HT007, MGC111203
Gene Description
transmembrane protein 126B
Gene Ontology
HyperlinkOther Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com