DCP1A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DCP1A protein.
Immunogen
DCP1A (AAH07439.1, 1 a.a. ~ 582 a.a) full-length human protein.
Sequence
MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DCP1A MaxPab polyclonal antibody. Western Blot analysis of DCP1A expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of DCP1A expression in transfected 293T cell line (H00055802-T01) by DCP1A MaxPab polyclonal antibody.
Lane 1: DCP1A transfected lysate(64.02 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DCP1A
Entrez GeneID
55802GeneBank Accession#
BC007439.2Protein Accession#
AAH07439.1Gene Name
DCP1A
Gene Alias
FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF
Gene Description
DCP1 decapping enzyme homolog A (S. cerevisiae)
Omim ID
607010Gene Ontology
HyperlinkGene Summary
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
Other Designations
DCP1 decapping enzyme homolog A|Smad4-interacting transcriptional co-activator|decapping enzyme hDcp1a|putative protein product of Nbla00360|transcription factor SMIF
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com