MBD5 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MBD5 MaxPab rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in human liver.
Western Blot (Cell lysate)
MBD5 MaxPab rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of MBD5 expression in transfected 293T cell line (H00055777-T02) by MBD5 MaxPab polyclonal antibody.
Lane 1: MBD5 transfected lysate(24.30 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MBD5 protein.
Immunogen
MBD5 (AAH14534.1, 1 a.a. ~ 229 a.a) full-length human protein.
Sequence
MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MBD5 MaxPab rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in human liver.Western Blot (Cell lysate)
MBD5 MaxPab rabbit polyclonal antibody. Western Blot analysis of MBD5 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of MBD5 expression in transfected 293T cell line (H00055777-T02) by MBD5 MaxPab polyclonal antibody.
Lane 1: MBD5 transfected lysate(24.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MBD5
Entrez GeneID
55777GeneBank Accession#
BC014534.1Protein Accession#
AAH14534.1Gene Name
MBD5
Gene Alias
FLJ11113, FLJ30517, KIAA1461, MRD1
Gene Description
methyl-CpG binding domain protein 5
Gene Ontology
HyperlinkOther Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com