N4BP2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
N4BP2 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of N4BP2 expression in SJCRH30 ( Cat # L027V1 ).
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant N4BP2.
Immunogen
N4BP2 (NP_060647, 1671 a.a. ~ 1770 a.a) partial recombinant protein with GST tag.
Sequence
HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
N4BP2 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of N4BP2 expression in SJCRH30 ( Cat # L027V1 ).ELISA
-
Gene Info — N4BP2
Entrez GeneID
55728GeneBank Accession#
NM_018177Protein Accession#
NP_060647Gene Name
N4BP2
Gene Alias
B3BP, FLJ10680, KIAA1413
Gene Description
NEDD4 binding protein 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein containing a polynucleotide kinase domain (PNK) near the N-terminal region, and a Small MutS Related (Smr) domain near the C-terminal region. The encoded protein can bind to both B-cell leukemia/lymphoma 3 (BCL-3) and neural precursor cell expressed, developmentally downregulated 4, (Nedd4) proteins. This protein binds and hydrolyzes ATP, may function as a 5'-polynucleotide kinase, and has the capacity to be a ubiquitylation substrate. This protein may play a role in transcription-coupled DNA repair or genetic recombination. [provided by RefSeq
Other Designations
BCL-3 binding protein|Nedd4 binding protein 2|OTTHUMP00000158757
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com