Product Browser

Last updated: 2014/10/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRMU purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00055687-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TRMU protein.
  • Immunogen:
  • TRMU (AAH80631.1, 1 a.a. ~ 222 a.a) full-length human protein.
  • Sequence:
  • MKKSLSRSTLRSPNGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVCCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TRMU expression in transfected 293T cell line (H00055687-T01) by TRMU MaxPab polyclonal antibody.

    Lane 1: TRMU transfected lysate(24.42 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • TRMU
  • Gene Alias:
  • MGC99627,MTO2,MTU1,TRMT,TRMT1,TRNT1
  • Gene Description:
  • tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
  • Gene Summary:
  • This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon. [provided by RefSeq
  • Other Designations:
  • mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase,mitochondrial tRNA-specific 2-thiouridylase 1,tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook