STYK1 monoclonal antibody (M02), clone 3D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STYK1.
Immunogen
STYK1 (NP_060893, 50 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (77)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STYK1 monoclonal antibody (M02), clone 3D2 Western Blot analysis of STYK1 expression in HepG2( Cat # L019V1 ).Western Blot (Cell lysate)
STYK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of STYK1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
STYK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of STYK1 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STYK1 expression in transfected 293T cell line by STYK1 monoclonal antibody (M02), clone 3D2.
Lane 1: STYK1 transfected lysate(47.547 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STYK1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — STYK1
Entrez GeneID
55359GeneBank Accession#
NM_018423Protein Accession#
NP_060893Gene Name
STYK1
Gene Alias
DKFZp761P1010, NOK, SuRTK106
Gene Description
serine/threonine/tyrosine kinase 1
Omim ID
611433Gene Ontology
HyperlinkGene Summary
Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM
Other Designations
protein kinase STYK1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com