Product Browser

Last updated: 2014/10/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STYK1 monoclonal antibody (M02), clone 3D2

  • Catalog # : H00055359-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant STYK1.
  • Immunogen:
  • STYK1 (NP_060893, 50 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055359-M02
    Western Blot detection against Immunogen (37.84 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STYK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of STYK1 expression in PC-12(Cat # L012V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STYK1 monoclonal antibody (M02), clone 3D2 Western Blot analysis of STYK1 expression in HepG2( Cat # L019V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STYK1 monoclonal antibody (M02), clone 3D2. Western Blot analysis of STYK1 expression in NIH/3T3(Cat # L018V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of STYK1 expression in transfected 293T cell line by STYK1 monoclonal antibody (M02), clone 3D2.

    Lane 1: STYK1 transfected lysate(47.547 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged STYK1 is approximately 3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • STYK1
  • Gene Alias:
  • DKFZp761P1010,NOK,SuRTK106
  • Gene Description:
  • serine/threonine/tyrosine kinase 1
  • Gene Summary:
  • Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM
  • Other Designations:
  • protein kinase STYK1
  • RSS
  • YouTube
  • Linkedin
  • Facebook