STYK1 monoclonal antibody (M01), clone 3A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of STYK1 expression in transfected 293T cell line by STYK1 monoclonal antibody (M01), clone 3A8.
Lane 1: STYK1 transfected lysate(47.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STYK1 is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of STYK1 over-expressed 293 cell line, cotransfected with STYK1 Validated Chimera RNAi ( Cat # H00055359-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with STYK1 monoclonal antibody (M01), clone 3A8 (Cat # H00055359-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control."
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STYK1.
Immunogen
STYK1 (NP_060893, 50 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of STYK1 expression in transfected 293T cell line by STYK1 monoclonal antibody (M01), clone 3A8.
Lane 1: STYK1 transfected lysate(47.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STYK1 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of STYK1 over-expressed 293 cell line, cotransfected with STYK1 Validated Chimera RNAi ( Cat # H00055359-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with STYK1 monoclonal antibody (M01), clone 3A8 (Cat # H00055359-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control." -
Gene Info — STYK1
Entrez GeneID
55359GeneBank Accession#
NM_018423Protein Accession#
NP_060893Gene Name
STYK1
Gene Alias
DKFZp761P1010, NOK, SuRTK106
Gene Description
serine/threonine/tyrosine kinase 1
Omim ID
611433Gene Ontology
HyperlinkGene Summary
Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM
Other Designations
protein kinase STYK1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com