VNN3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
VNN3 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of VNN3 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant VNN3.
Immunogen
VNN3 (NP_060869.2, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag.
Sequence
ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
VNN3 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of VNN3 expression in MES-SA/Dx5 ( Cat # L021V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — VNN3
Entrez GeneID
55350GeneBank Accession#
NM_018399Protein Accession#
NP_060869.2Gene Name
VNN3
Gene Alias
HSA238982, MGC171203, PAGEL-beta, PAGEL-eta, PAGEL-zeta
Gene Description
vanin 3
Omim ID
606592Gene Ontology
HyperlinkGene Summary
This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq
Other Designations
PAGEL-alpha|PAGEL-delta|PAGEL-epsilon|PAGEL-gamma|pantetheinase|pantetheinase-associated gene expressed in leukocytes (PAGEL)-alpha|vanin 3, isoform 3
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com