C9orf95 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of C9orf95 expression in transfected 293T cell line (H00054981-T01) by C9orf95 MaxPab polyclonal antibody.
Lane 1: C9orf95 transfected lysate(21.89 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C9orf95 protein.
Immunogen
C9orf95 (NP_060351.1, 1 a.a. ~ 199 a.a) full-length human protein.
Sequence
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C9orf95 expression in transfected 293T cell line (H00054981-T01) by C9orf95 MaxPab polyclonal antibody.
Lane 1: C9orf95 transfected lysate(21.89 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C9orf95
Entrez GeneID
54981GeneBank Accession#
NM_017881.1Protein Accession#
NP_060351.1Gene Name
C9orf95
Gene Alias
FLJ20559, NRK1, RP11-235O14.2, bA235O14.2
Gene Description
chromosome 9 open reading frame 95
Omim ID
608704Gene Ontology
HyperlinkGene Summary
Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM
Other Designations
OTTHUMP00000021493|nicotinamide riboside kinase 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com