Product Browser

Last updated: 2014/9/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00054769-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DIRAS2 protein.
  • Immunogen:
  • DIRAS2 (NP_060064.2, 1 a.a. ~ 199 a.a) full-length human protein.
  • Sequence:
  • MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DIRAS2 expression in transfected 293T cell line (H00054769-T01) by DIRAS2 MaxPab polyclonal antibody.

    Lane 1: DIRAS2 transfected lysate(21.89 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • DIRAS2
  • Gene Alias:
  • DKFZp761C07121,Di-Ras2
  • Gene Description:
  • DIRAS family, GTP-binding RAS-like 2
  • Gene Summary:
  • DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM
  • Other Designations:
  • Di-Ras2,OTTHUMP00000021626
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook