Product Browser

Last updated: 2014/8/18
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DIRAS2 polyclonal antibody (A01)

  • Catalog # : H00054769-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DIRAS2.
  • Immunogen:
  • DIRAS2 (NP_060064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00054769-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DIRAS2 expression in transfected 293T cell line by DIRAS2 polyclonal antibody (A01).

    Lane1:DIRAS2 transfected lysate (Predicted MW: 22.5 KDa).
    Lane2:Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DIRAS2
  • Gene Alias:
  • DKFZp761C07121,Di-Ras2
  • Gene Description:
  • DIRAS family, GTP-binding RAS-like 2
  • Gene Summary:
  • DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM
  • Other Designations:
  • Di-Ras2,OTTHUMP00000021626
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook