Product Browser

Last updated: 2014/11/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLE3 MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00054107-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human POLE3 protein.
  • Immunogen:
  • POLE3 (AAH03166, 1 a.a. ~ 147 a.a) full-length human protein.
  • Sequence:
  • MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • POLE3 MaxPab polyclonal antibody. Western Blot analysis of POLE3 expression in human liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T02) by POLE3 MaxPab polyclonal antibody.

    Lane 1: POLE3 transfected lysate(16.17 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • POLE3
  • Gene Alias:
  • CHARAC17,CHRAC17,YBL1,p17
  • Gene Description:
  • polymerase (DNA directed), epsilon 3 (p17 subunit)
  • Gene Summary:
  • POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM
  • Other Designations:
  • DNA polymerase epsilon p17 subunit,DNA polymerase epsilon subunit 3,OTTHUMP00000021954,OTTHUMP00000021955,arsenic transactivated protein,chromatin accessibility complex 17,histone fold protein CHRAC17
  • RSS
  • YouTube
  • Linkedin
  • Facebook