MBD3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MBD3 MaxPab polyclonal antibody. Western Blot analysis of MBD3 expression in 293.
Western Blot (Transfected lysate)
Western Blot analysis of MBD3 expression in transfected 293T cell line (H00053615-T01) by MBD3 MaxPab polyclonal antibody.
Lane 1: MBD3 transfected lysate(32.01 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MBD3 protein.
Immunogen
MBD3 (NP_003917.1, 1 a.a. ~ 291 a.a) full-length human protein.
Sequence
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MBD3 MaxPab polyclonal antibody. Western Blot analysis of MBD3 expression in 293.Western Blot (Transfected lysate)
Western Blot analysis of MBD3 expression in transfected 293T cell line (H00053615-T01) by MBD3 MaxPab polyclonal antibody.
Lane 1: MBD3 transfected lysate(32.01 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MBD3
Entrez GeneID
53615GeneBank Accession#
NM_003926.5Protein Accession#
NP_003917.1Gene Name
MBD3
Gene Alias
-
Gene Description
methyl-CpG binding domain protein 3
Omim ID
603573Gene Ontology
HyperlinkGene Summary
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3. MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com