POLR3K MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POLR3K expression in transfected 293T cell line (H00051728-T01) by POLR3K MaxPab polyclonal antibody.
Lane 1: POLR3K transfected lysate(11.99 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to POLR3K on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human POLR3K protein.
Immunogen
POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length human protein.
Sequence
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLR3K expression in transfected 293T cell line (H00051728-T01) by POLR3K MaxPab polyclonal antibody.
Lane 1: POLR3K transfected lysate(11.99 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to POLR3K on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — POLR3K
Entrez GeneID
51728GeneBank Accession#
BC011932Protein Accession#
AAH11932Gene Name
POLR3K
Gene Alias
C11, C11-RNP3, My010, RPC10, RPC11, hRPC11
Gene Description
polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Omim ID
606007Gene Ontology
HyperlinkGene Summary
This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. [provided by RefSeq
Other Designations
DNA directed RNA polymerase III polypeptide K|RNA polymerase III subunit (hRPC11)|RNA polymerase III subunit CII
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com