PPIL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPIL1 partial ORF ( NP_057143, 76 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.75
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPIL1
Entrez GeneID
51645GeneBank Accession#
NM_016059Protein Accession#
NP_057143Gene Name
PPIL1
Gene Alias
CGI-124, CYPL1, MGC678, PPIase, hCyPX
Gene Description
peptidylprolyl isomerase (cyclophilin)-like 1
Omim ID
601301Gene Ontology
HyperlinkGene Summary
This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq
Other Designations
OTTHUMP00000016310|cyclophilin-related gene 1|peptidyl-prolyl cis-trans isomerase|peptidylprolyl isomerase-like 1|rotamase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com