PPIL1 monoclonal antibody (M01), clone 2C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPIL1.
Immunogen
PPIL1 (NP_057143, 76 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPIL1 monoclonal antibody (M01), clone 2C2 Western Blot analysis of PPIL1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PPIL1 expression in transfected 293T cell line by PPIL1 monoclonal antibody (M01), clone 2C2.
Lane 1: PPIL1 transfected lysate(18.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPIL1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — PPIL1
Entrez GeneID
51645GeneBank Accession#
NM_016059Protein Accession#
NP_057143Gene Name
PPIL1
Gene Alias
CGI-124, CYPL1, MGC678, PPIase, hCyPX
Gene Description
peptidylprolyl isomerase (cyclophilin)-like 1
Omim ID
601301Gene Ontology
HyperlinkGene Summary
This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq
Other Designations
OTTHUMP00000016310|cyclophilin-related gene 1|peptidyl-prolyl cis-trans isomerase|peptidylprolyl isomerase-like 1|rotamase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com