ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ARMCX3 expression in transfected 293T cell line (H00051566-T02) by ARMCX3 MaxPab polyclonal antibody.
Lane 1: ARMCX3 transfected lysate(42.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ARMCX3 protein.
Immunogen
ARMCX3 (NP_057691.1, 1 a.a. ~ 379 a.a) full-length human protein.
Sequence
MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ARMCX3 expression in transfected 293T cell line (H00051566-T02) by ARMCX3 MaxPab polyclonal antibody.
Lane 1: ARMCX3 transfected lysate(42.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ARMCX3
Entrez GeneID
51566GeneBank Accession#
NM_016607Protein Accession#
NP_057691.1Gene Name
ARMCX3
Gene Alias
ALEX3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2
Gene Description
armadillo repeat containing, X-linked 3
Omim ID
300364Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
1200004E24Rik|OTTHUMP00000023688|arm protein lost in epithelial cancers, X chromosome, 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com