Product Browser

Last updated: 2014/9/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZBTB7A monoclonal antibody (M07), clone 2A2

  • Catalog # : H00051341-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant ZBTB7A.
  • Immunogen:
  • ZBTB7A (AAH19108, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ZBTB7A is 3 ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • ZBTB7A
  • Gene Alias:
  • DKFZp547O146,FBI-1,FBI1,LRF,MGC99631,ZBTB7,ZNF857A,pokemon
  • Gene Description:
  • zinc finger and BTB domain containing 7A
  • Other Designations:
  • HIV-1 inducer of short transcripts binding protein,lymphoma related factor,zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook