Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ZBTB7A monoclonal antibody (M07), clone 2A2   

  • Catalog # : H00051341-M07
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant ZBTB7A.
  • Immunogen:
  • ZBTB7A (AAH19108, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ZBTB7A is 3 ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • ZBTB7A
  • Gene Alias:
  • DKFZp547O146,FBI-1,FBI1,LRF,MGC99631,ZBTB7,ZNF857A,pokemon
  • Gene Description:
  • zinc finger and BTB domain containing 7A
  • Other Designations:
  • HIV-1 inducer of short transcripts binding protein,lymphoma related factor,zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!