FKBP11 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FKBP11 MaxPab polyclonal antibody. Western Blot analysis of FKBP11 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of FKBP11 expression in transfected 293T cell line (H00051303-T01) by FKBP11 MaxPab polyclonal antibody.
Lane 1: FKBP11 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FKBP11 protein.
Immunogen
FKBP11 (NP_057678.1, 1 a.a. ~ 201 a.a) full-length human protein.
Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FKBP11 MaxPab polyclonal antibody. Western Blot analysis of FKBP11 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of FKBP11 expression in transfected 293T cell line (H00051303-T01) by FKBP11 MaxPab polyclonal antibody.
Lane 1: FKBP11 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FKBP11
Entrez GeneID
51303GeneBank Accession#
NM_016594.1Protein Accession#
NP_057678.1Gene Name
FKBP11
Gene Alias
FKBP19, MGC54182
Gene Description
FK506 binding protein 11, 19 kDa
Omim ID
610571Gene Ontology
HyperlinkGene Summary
FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com