LEF1 monoclonal antibody (M05), clone 1H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LEF1 monoclonal antibody (M05), clone 1H2 Western Blot analysis of LEF1 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M05), clone 1H2.
Lane 1: LEF1 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LEF1.
Immunogen
LEF1 (NP_057353, 14 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LEF1 monoclonal antibody (M05), clone 1H2 Western Blot analysis of LEF1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M05), clone 1H2.
Lane 1: LEF1 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — LEF1
Entrez GeneID
51176GeneBank Accession#
NM_016269Protein Accession#
NP_057353Gene Name
LEF1
Gene Alias
DKFZp586H0919, TCF1ALPHA
Gene Description
lymphoid enhancer-binding factor 1
Omim ID
153245Gene Ontology
HyperlinkGene Summary
LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]).[supplied by OMIM
Other Designations
lymphoid enhancer binding factor-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com