LEF1 monoclonal antibody (M01), clone 3H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LEF1 monoclonal antibody (M01), clone 3H5 Western Blot analysis of LEF1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Western Blot (Cell lysate)
LEF1 monoclonal antibody (M01), clone 3H5. Western Blot analysis of LEF1 expression in HL-60 ( Cat # L014V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5.
Lane 1: LEF1 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (69.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LEF1.
Immunogen
LEF1 (AAH50632, 1 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (69.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LEF1 monoclonal antibody (M01), clone 3H5 Western Blot analysis of LEF1 expression in MES-SA/Dx5 ( Cat # L021V1 ).Western Blot (Cell lysate)
LEF1 monoclonal antibody (M01), clone 3H5. Western Blot analysis of LEF1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5.
Lane 1: LEF1 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — LEF1
Entrez GeneID
51176GeneBank Accession#
BC050632Protein Accession#
AAH50632Gene Name
LEF1
Gene Alias
DKFZp586H0919, TCF1ALPHA
Gene Description
lymphoid enhancer-binding factor 1
Omim ID
153245Gene Ontology
HyperlinkGene Summary
LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]).[supplied by OMIM
Other Designations
lymphoid enhancer binding factor-1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Rac1 augments Wnt signaling by stimulating β-catenin-LEF-1 complex assembly independent of β-catenin nuclear import.
Jamieson C, Lui C, Brocardo MG, Martino-Echarri E, Henderson BR.
Journal of Cell Science 2015 Nov; 128(21):3933.
Application：WB-Ce, PLA, Human, HEK 293, HEK 293T cells.
-
Regulation of β-catenin nuclear dynamics by GSK-3β involves a LEF-1 positive feedback loop.
Jamieson C, Sharma M, Henderson BR.
Traffic 2011 Apr; 12:983.
Application：IF, Mouse, NIH 3T3 cells.
-
LEF-1 negatively controls interleukin-4 expression through a proximal promoter regulatory element.
Hebenstreit D, Giaisi M, Treiber MK, Zhang XB, Mi HF, Horejs-Hoeck J, Andersen KG, Krammer PH, Duschl A, Li-Weber M.
The Journal of Biological Chemistry 2008 Jun; 283(33):22490.
Application：WB, Human, Human T-cell leukemia cell line Th2 D10, Th1 C29, and Jurkat cells.
-
Rac1 augments Wnt signaling by stimulating β-catenin-LEF-1 complex assembly independent of β-catenin nuclear import.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com