ANGPTL4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ANGPTL4 protein.
Immunogen
ANGPTL4 (NP_647475.1, 1 a.a. ~ 406 a.a) full-length human protein.
Sequence
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (75); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in RIN-m5F.Western Blot (Cell lysate)
ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in HeLa.Western Blot (Cell lysate)
ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of ANGPTL4 expression in transfected 293T cell line (H00051129-T02) by ANGPTL4 MaxPab polyclonal antibody.
Lane 1: ANGPTL4 transfected lysate(44.66 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ANGPTL4
Entrez GeneID
51129GeneBank Accession#
NM_139314Protein Accession#
NP_647475.1Gene Name
ANGPTL4
Gene Alias
ANGPTL2, ARP4, FIAF, HFARP, NL2, PGAR, pp1158
Gene Description
angiopoietin-like 4
Omim ID
605910Gene Ontology
HyperlinkGene Summary
This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. This gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. The encoded protein is a serum hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity and also acts as an apoptosis survival factor for vascular endothelial cells. The encoded protein may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq
Other Designations
PPARG angiopoietin related protein|angiopoietin-like 4 protein|angiopoietin-related protein 4|fasting-induced adipose factor|hepatic angiopoietin-related protein|hepatic fibrinogen/angiopoietin-related protein|peroxisome proliferator-activated receptor (P
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
High Concentrations of Angiopoietin-Like Protein 4 Detected in Serum from Patients with Rheumatoid Arthritis Can Be Explained by Non-Specific Antibody Reactivity.
Makoveichuk E, Ruge T, Nilsson S, Södergren A, Olivecrona G.
PLoS One 2017 Jan; 12(1):e0168922.
Application:ELISA, Human, Serum from Patients with Rheumatoid Arthritis.
-
Inactivation of lipoprotein lipase occurs on the surface of THP-1 macrophages where oligomers of angiopoietin-like protein 4 are formed.
Makoveichuk E, Sukonina V, Kroupa O, Thulin P, Ehrenborg E, Olivecrona T, Olivecrona G.
Biochemical and Biophysical Research Communications 2012 Aug; 425(2):138.
Application:WB, Human, THP-1 cells.
-
High Concentrations of Angiopoietin-Like Protein 4 Detected in Serum from Patients with Rheumatoid Arthritis Can Be Explained by Non-Specific Antibody Reactivity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com