Product Browser

Last updated: 2014/10/20
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR1D MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00051082-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human POLR1D protein.
  • Immunogen:
  • POLR1D (NP_057056.1, 1 a.a. ~ 133 a.a) full-length human protein.
  • Sequence:
  • MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POLR1D expression in transfected 293T cell line (H00051082-T01) by POLR1D MaxPab polyclonal antibody.

    Lane 1: POLR1D transfected lysate(15.20 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of POLR1D transfected lysate using anti-POLR1D MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with POLR1D MaxPab rabbit polyclonal antibody (D01) (H00051082-D01).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • POLR1D
  • Gene Alias:
  • FLJ20616,MGC9850,POLR1C,RPA16,RPA9,RPAC2,RPO1-3
  • Gene Description:
  • polymerase (RNA) I polypeptide D, 16kDa
  • Other Designations:
  • OTTHUMP00000018171,OTTHUMP00000018172,RNA polymerase I 16 kDa subunit,polymerase (RNA) I polypeptide D
  • RSS
  • YouTube
  • Linkedin
  • Facebook