Product Browser

Last updated: 2014/8/18
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FIS1 monoclonal antibody (M01A), clone 1G9

  • Catalog # : H00051024-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant FIS1.
  • Immunogen:
  • FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051024-M01A
    Western Blot detection against Immunogen (42.46 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FIS1 monoclonal antibody (M01A), clone 1G9. Western Blot analysis of FIS1 expression in human liver.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FIS1 monoclonal antibody (M01A), clone 1G9 Western Blot analysis of FIS1 expression in A-431 ( Cat # L015V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • FIS1
  • Gene Alias:
  • CGI-135,TTC11
  • Gene Description:
  • fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
  • Gene Summary:
  • The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM
  • Other Designations:
  • H_NH0132A01.6,tetratricopeptide repeat domain 11
  • RSS
  • YouTube
  • Linkedin
  • Facebook