Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TTC11 polyclonal antibody (A01)

  • Catalog # : H00051024-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant TTC11.
  • Immunogen:
  • TTC11 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051024-A01
    Western Blot detection against Immunogen (42.83 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TTC11 polyclonal antibody (A01), Lot # 051206JC01 Western Blot analysis of FIS1 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • FIS1
  • Gene Alias:
  • CGI-135,TTC11
  • Gene Description:
  • fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
  • Gene Summary:
  • The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM
  • Other Designations:
  • H_NH0132A01.6,tetratricopeptide repeat domain 11
  • RSS
  • YouTube
  • Linkedin
  • Facebook