TBX22 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TBX22 MaxPab rabbit polyclonal antibody. Western Blot analysis of TBX22 expression in human liver.
Western Blot (Tissue lysate)
TBX22 MaxPab rabbit polyclonal antibody. Western Blot analysis of TBX22 expression in mouse liver.
Western Blot (Transfected lysate)
Western Blot analysis of TBX22 expression in transfected 293T cell line (H00050945-T02) by TBX22 MaxPab polyclonal antibody.
Lane 1: TBX22 transfected lysate(57.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TBX22 protein.
Immunogen
TBX22 (NP_058650.1, 1 a.a. ~ 520 a.a) full-length human protein.
Sequence
MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSSAAGKSEPLEKQPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRRMFPSVRVKVKGLDPGKQYHVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHPDSPCSGETWMRQIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPWRPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (72); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TBX22 MaxPab rabbit polyclonal antibody. Western Blot analysis of TBX22 expression in human liver.Western Blot (Tissue lysate)
TBX22 MaxPab rabbit polyclonal antibody. Western Blot analysis of TBX22 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of TBX22 expression in transfected 293T cell line (H00050945-T02) by TBX22 MaxPab polyclonal antibody.
Lane 1: TBX22 transfected lysate(57.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TBX22
Entrez GeneID
50945GeneBank Accession#
NM_016954.2Protein Accession#
NP_058650.1Gene Name
TBX22
Gene Alias
CLPA, TBXX, dJ795G23.1
Gene Description
T-box 22
Gene Ontology
HyperlinkGene Summary
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene have been associated with the inherited X-linked disorder, Cleft palate with ankyloglossia, and it is believed to play a major role in human palatogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023602|OTTHUMP00000023603|OTTHUMP00000023604
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com