CD207 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CD207 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.
Western Blot (Transfected lysate)
Western Blot analysis of CD207 expression in transfected 293T cell line (H00050489-T03) by CD207 MaxPab polyclonal antibody.
Lane 1: CD207 transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CD207 transfected lysate using anti-CD207 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD207 MaxPab mouse polyclonal antibody (B02) (H00050489-B02).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CD207 protein.
Immunogen
CD207 (AAH22278.1, 1 a.a. ~ 328 a.a) full-length human protein.
Sequence
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (67); Rat (64)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CD207 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of CD207 expression in transfected 293T cell line (H00050489-T03) by CD207 MaxPab polyclonal antibody.
Lane 1: CD207 transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CD207 transfected lysate using anti-CD207 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD207 MaxPab mouse polyclonal antibody (B02) (H00050489-B02). -
Gene Info — CD207
Entrez GeneID
50489GeneBank Accession#
BC022278.1Protein Accession#
AAH22278.1Gene Name
CD207
Gene Alias
CLEC4K
Gene Description
CD207 molecule, langerin
Omim ID
604862Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. [provided by RefSeq
Other Designations
C-type lectin domain family 4, member K|CD207 antigen, langerin|Langerhans cell specific c-type lectin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com