Product Browser

Last updated: 2014/10/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ICOS (Human) Recombinant Protein (Q01)

  • Catalog # : H00029851-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ICOS partial ORF (NP_036224.1, 21 a.a. - 140 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.83
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00029851-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ICOS
  • Gene Alias:
  • AILIM,CD278,MGC39850
  • Gene Description:
  • inducible T-cell co-stimulator
  • Gene Summary:
  • The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq
  • Other Designations:
  • activation-inducible lymphocyte immunomediatory molecule,inducible costimulator
  • RSS
  • YouTube
  • Linkedin
  • Facebook