BLNK monoclonal antibody (M04), clone 1D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BLNK.
Immunogen
BLNK (AAH18906, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BLNK monoclonal antibody (M04), clone 1D7. Western Blot analysis of BLNK expression in rat brain.Western Blot (Cell lysate)
BLNK monoclonal antibody (M04), clone 1D7. Western Blot analysis of BLNK expression in IMR-32.Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-BLNK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — BLNK
Entrez GeneID
29760GeneBank Accession#
BC018906Protein Accession#
AAH18906Gene Name
BLNK
Gene Alias
BASH, BLNK-S, LY57, MGC111051, SLP-65, SLP65
Gene Description
B-cell linker
Omim ID
604515Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
B cell linker protein|B-cell adapter containing a SH2 domain protein|B-cell adapter containing a Src homology 2 domain protein|OTTHUMP00000020167|Src homology 2 domain-containing leukocyte protein of 65 kDa
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com