Product Browser

Last updated: 2014/11/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLEC2D (Human) Recombinant Protein (P01)

  • Catalog # : H00029121-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLEC2D full-length ORF ( AAH19883, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.68
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00029121-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CLEC2D
  • Gene Alias:
  • CLAX,LLT1,OCIL
  • Gene Description:
  • C-type lectin domain family 2, member D
  • Gene Summary:
  • This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified, but the full-length nature of every transcript has not been defined. [provided by RefSeq
  • Other Designations:
  • C-type lectin related f,C-type lectin superfamily 2, member D,lectin-like NK cell receptor,lectin-like transcript 1,osteoclast inhibitory lectin
  • RSS
  • YouTube
  • Linkedin
  • Facebook