OR8B8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OR8B8 MaxPab polyclonal antibody. Western Blot analysis of OR8B8 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of OR8B8 expression in transfected 293T cell line (H00026493-T01) by OR8B8 MaxPab polyclonal antibody.
Lane 1: OR8B8 transfected lysate(34.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to OR8B8 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human OR8B8 protein.
Immunogen
OR8B8 (NP_036510.1, 1 a.a. ~ 311 a.a) full-length human protein.
Sequence
MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVALKKILNKNAFS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OR8B8 MaxPab polyclonal antibody. Western Blot analysis of OR8B8 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of OR8B8 expression in transfected 293T cell line (H00026493-T01) by OR8B8 MaxPab polyclonal antibody.
Lane 1: OR8B8 transfected lysate(34.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to OR8B8 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — OR8B8
Entrez GeneID
26493GeneBank Accession#
NM_012378.1Protein Accession#
NP_036510.1Gene Name
OR8B8
Gene Alias
TPCR85
Gene Description
olfactory receptor, family 8, subfamily B, member 8
Gene Ontology
HyperlinkGene Summary
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq
Other Designations
olfactory receptor 8B8|olfactory receptor OR11-316|olfactory-like receptor JCG8
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com