HECTD1 monoclonal antibody (M03), clone 1E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HECTD1.
Immunogen
HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HECTD1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — HECTD1
-
Interactome
-
Publication Reference
-
HECTD1 regulates the expression of SNAIL: Implications for epithelial‑mesenchymal transition.
Xinggang Wang, Christian De Geyter, Zanhui Jia, Ya Peng, Hong Zhang.
International Journal of Oncology 2020 May; 56(5):1186.
Application:IF, WB-Tr, Human, HeLa cells.
-
HECTD1 controls the protein level of IQGAP1 to regulate the dynamics of adhesive structures.
Shen X, Jia Z, D'Alonzo D, Wang X, Bruder E, Emch FH, De Geyter C, Zhang H.
Cell Communication and Signaling 2017 Jan; 15(1):2.
Application:IF, Human, HeLa cells.
-
Hectd1 regulates intracellular localization and secretion of Hsp90 to control cellular behavior of the cranial mesenchyme.
Sarkar AA, Zohn IE.
The Journal of Cell Biology 2012 Mar; 196(6):789.
Application:IF, IP, IP-WB, WB-Ti, WB-Tr, Human, Mouse, Embryo, HEK 293T cells.
-
HECTD1 regulates the expression of SNAIL: Implications for epithelial‑mesenchymal transition.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com