QPCT MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
QPCT MaxPab polyclonal antibody. Western Blot analysis of QPCT expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of QPCT expression in transfected 293T cell line (H00025797-T01) by QPCT MaxPab polyclonal antibody.
Lane 1: QPCT transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human QPCT protein.
Immunogen
QPCT (NP_036545, 1 a.a. ~ 361 a.a) full-length human protein.
Sequence
MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (69)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Cell lysate)
QPCT MaxPab polyclonal antibody. Western Blot analysis of QPCT expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of QPCT expression in transfected 293T cell line (H00025797-T01) by QPCT MaxPab polyclonal antibody.
Lane 1: QPCT transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — QPCT
Entrez GeneID
25797GeneBank Accession#
NM_012413Protein Accession#
NP_036545Gene Name
QPCT
Gene Alias
GCT, QC
Gene Description
glutaminyl-peptide cyclotransferase
Omim ID
607065Gene Ontology
HyperlinkGene Summary
This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq
Other Designations
glutaminyl cyclase
-
Interactome
-
Disease
-
Publication Reference
-
Glutaminyl Cyclase in Human Cortex: Correlation with (pGlu)-Amyloid-β Load and Cognitive Decline in Alzheimers Disease.
Morawski M, Schilling S, Kreuzberger M, Waniek A, Jager C, Koch B, Cynis H, Kehlen A, Arendt T, Hartlage-Rubsamen M, Demuth HU, Rossner S.
Journal of Alzheimer's Disease 2014 Jan; 39(2):385.
Application：IHC, Human, Brain.
-
Glutaminyl Cyclase in Human Cortex: Correlation with (pGlu)-Amyloid-β Load and Cognitive Decline in Alzheimers Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com