Product Browser

Last updated: 2014/10/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OSBP2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023762-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human OSBP2 partial ORF ( NP_110385.1, 818 a.a. - 916 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023762-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • OSBP2
  • Gene Alias:
  • ORP-4,ORP4,OSBPL1,OSBPL4
  • Gene Description:
  • oxysterol binding protein 2
  • Gene Summary:
  • Oxysterols are byproducts of cholesterol that can have cytotoxic effects on many cell types. The membrane-bound protein encoded by this gene contains a pleckstrin homology (PH) domain and an oxysterol-binding region. It binds oxysterols such as 7-ketocholesterol and may inhibit their cytotoxicity. Alternate transcriptional splice variants have been observed but have not been fully characterized. [provided by RefSeq
  • Other Designations:
  • OSBP-related protein 4,OTTHUMP00000028525,oxysterol binding protein-like 1,oxysterol binding protein-related protein 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook