POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human POFUT1 protein.
Immunogen
POFUT1 (NP_758436.1, 1 a.a. ~ 194 a.a) full-length human protein.
Sequence
MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
POFUT1 MaxPab rabbit polyclonal antibody. Western Blot analysis of POFUT1 expression in mouse kidney.Western Blot (Cell lysate)
POFUT1 MaxPab rabbit polyclonal antibody. Western Blot analysis of POFUT1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of POFUT1 expression in transfected 293T cell line (H00023509-T02) by POFUT1 MaxPab polyclonal antibody.
Lane 1: POFUT1 transfected lysate(22.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — POFUT1
Entrez GeneID
23509GeneBank Accession#
NM_172236Protein Accession#
NP_758436.1Gene Name
POFUT1
Gene Alias
FUT12, KIAA0180, MGC2482, O-FUT, O-Fuc-T, O-FucT-1
Gene Description
protein O-fucosyltransferase 1
Omim ID
607491Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
GDP-fucose protein O-fucosyltransferase 1|OTTHUMP00000030583|OTTHUMP00000030584|o-fucosyltransferase protein
-
Interactome
-
Disease
-
Publication Reference
-
Downregulated protein O-fucosyl transferase 1 (Pofut1) expression exerts antiproliferative and antiadhesive effects on hepatocytes by inhibiting Notch signalling.
Annani-Akollor ME, Wang S, Fan J, Liu L, Padhiar AA, Zhang J.
Biomedicine & Pharmacotherapy 2014 Jul; 68(6):785.
Application:WB-Ce, WB-Tr, Human, HepG2, SMMC-7721, L-02 cells.
-
Downregulated protein O-fucosyl transferase 1 (Pofut1) expression exerts antiproliferative and antiadhesive effects on hepatocytes by inhibiting Notch signalling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com