Product Browser

Last updated: 2014/9/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TARDBP polyclonal antibody (A01)

  • Catalog # : H00023435-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant TARDBP.
  • Immunogen:
  • TARDBP (AAH01487.1, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023435-A01
    Western Blot detection against Immunogen (54.34 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TARDBP polyclonal antibody (A01), Lot # Abnova060510QCS1 Western Blot analysis of TARDBP expression in IMR-32 ( Cat # L008V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TARDBP
  • Gene Alias:
  • ALS10,TDP-43
  • Gene Description:
  • TAR DNA binding protein
  • Gene Summary:
  • HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002171,TAR DNA-binding protein-43
  • RSS
  • YouTube
  • Linkedin
  • Facebook