- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Proteins/Peptides > Human > Partial-length > Transcriptions > ADNP (Human) Recombinant Protein (Q01)
ADNP (Human) Recombinant Protein (Q01)
- Catalog # : H00023394-Q01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 10 ug
- USD $ 319
- order now, ship in 5 days
-
- 25 ug
- USD $ 485
- order now, ship in 5 days
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Human ADNP partial ORF ( NP_056154, 1018 a.a. - 1102 a.a.) recombinant protein with GST-tag at N-terminal.
- Sequence:
- TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
- Theoretical MW (kDa):
- 35.09
- Preparation Method:
- in vitro wheat germ expression system
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Quality Control Testing:
- 12.5% SDS-PAGE Stained with Coomassie Blue.
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage Instruction:
- Store at -80°C. Aliquot to avoid repeated freezing and thawing.
- Note:
- Best use within three months from the date of receipt of this protein.
- MSDS:
Download
- Application Image
- Enzyme-linked Immunoabsorbent Assay
- Western Blot (Recombinant protein)
- Antibody Production
- Protein Array
- Entrez GeneID:
- 23394
- GeneBank Accession#:
- NM_015339
- Protein Accession#:
- NP_056154
- Gene Name:
- ADNP
- Gene Alias:
- ADNP1,KIAA0784
- Gene Description:
- activity-dependent neuroprotector homeobox
- Omim ID:
- 611386
- Gene Ontology:
- Hyperlink
- Gene Summary:
- Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
- Other Designations:
- ADNP homeobox 1,OTTHUMP00000031275,OTTHUMP00000165329,activity-dependent neuroprotective protein,activity-dependent neuroprotector
- Related Disease
