Product Browser

Last updated: 2014/11/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADNP (Human) Recombinant Protein (Q01)

  • Catalog # : H00023394-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADNP partial ORF ( NP_056154, 1018 a.a. - 1102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.09
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023394-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ADNP
  • Gene Alias:
  • ADNP1,KIAA0784
  • Gene Description:
  • activity-dependent neuroprotector homeobox
  • Gene Summary:
  • Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
  • Other Designations:
  • ADNP homeobox 1,OTTHUMP00000031275,OTTHUMP00000165329,activity-dependent neuroprotective protein,activity-dependent neuroprotector
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook