ADNP monoclonal antibody (M02), clone 2C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ADNP expression in transfected 293T cell line by ADNP monoclonal antibody (M02), clone 2C5.
Lane 1: ADNP transfected lysate (Predicted MW: 123.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADNP is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ADNP on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.09 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADNP.
Immunogen
ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ADNP expression in transfected 293T cell line by ADNP monoclonal antibody (M02), clone 2C5.
Lane 1: ADNP transfected lysate (Predicted MW: 123.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADNP is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ADNP on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ADNP
Entrez GeneID
23394GeneBank Accession#
NM_015339Protein Accession#
NP_056154Gene Name
ADNP
Gene Alias
ADNP1, KIAA0784
Gene Description
activity-dependent neuroprotector homeobox
Omim ID
611386Gene Ontology
HyperlinkGene Summary
Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations
ADNP homeobox 1|OTTHUMP00000031275|OTTHUMP00000165329|activity-dependent neuroprotective protein|activity-dependent neuroprotector
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com