UNC84A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UNC84A protein.
Immunogen
UNC84A (AAH13613, 1 a.a. ~ 257 a.a) full-length human protein.
Sequence
MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGSKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UNC84A expression in transfected 293T cell line (H00023353-T01) by UNC84A MaxPab polyclonal antibody.
Lane 1: UNC84A transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UNC84A
Entrez GeneID
23353GeneBank Accession#
BC013613Protein Accession#
AAH13613Gene Name
UNC84A
Gene Alias
FLJ12407, KIAA0810, MGC176649, SUN1
Gene Description
unc-84 homolog A (C. elegans)
Omim ID
607723Gene Ontology
HyperlinkGene Summary
This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
Sad1 unc-84 domain protein 1|unc-84 homolog A
-
Interactome
-
Disease
-
Publication Reference
-
Farnesylation of lamin B1 is important for retention of nuclear chromatin during neuronal migration.
Jung HJ, Nobumori C, Goulbourne CN, Tu Y, Lee JM, Tatar A, Wu D, Yoshinaga Y, de Jong PJ, Coffinier C, Fong LG, Young SG.
PNAS 2013 May; 110(21):E1923.
Application:IF, Mouse, Neurospheres.
-
Farnesylation of lamin B1 is important for retention of nuclear chromatin during neuronal migration.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com