Product Browser

Last updated: 2014/12/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRIM32 (Human) Recombinant Protein (Q01)

  • Catalog # : H00022954-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TRIM32 partial ORF ( NP_036342, 105 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00022954-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TRIM32
  • Gene Alias:
  • BBS11,HT2A,LGMD2H,TATIP
  • Gene Description:
  • tripartite motif-containing 32
  • Gene Summary:
  • The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq
  • Other Designations:
  • Limb-girdle muscular dystrophy 2H,OTTHUMP00000022763,TAT-interactive protein, 72-KD,limb girdle muscular dystrophy 2H (autosomal recessive),muscular dystrophy, Hutterite type,tripartite motif protein TRIM32,zinc-finger protein HT2A
  • RSS
  • YouTube
  • Linkedin
  • Facebook