Product Browser
 
  • Related Product Showcase
  • By Pathway
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

DKK1 monoclonal antibody (M09), clone 3C2   

  • Catalog # : H00022943-M09
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant DKK1.
  • Immunogen:
  • DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged DKK1 is approximately 3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DKK1
  • Gene Alias:
  • DKK-1,SK
  • Gene Description:
  • dickkopf homolog 1 (Xenopus laevis)
  • Gene Summary:
  • This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019617,dickkopf homolog 1,dickkopf related protein-1,dickkopf-1 like
  • Gene Pathway
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!