RPIA purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RPIA MaxPab rabbit polyclonal antibody. Western Blot analysis of RPIA expression in mouse kidney.
Western Blot (Tissue lysate)
RPIA MaxPab rabbit polyclonal antibody. Western Blot analysis of RPIA expression in human kidney.
Western Blot (Cell lysate)
RPIA MaxPab rabbit polyclonal antibody. Western Blot analysis of RPIA expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of RPIA expression in transfected 293T cell line (H00022934-T03) by RPIA MaxPab polyclonal antibody.
Lane 1: RPIA transfected lysate(26.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RPIA protein.
Immunogen
RPIA (ENSP00000283646, 1 a.a. ~ 237 a.a) full-length human protein.
Sequence
MSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RPIA MaxPab rabbit polyclonal antibody. Western Blot analysis of RPIA expression in mouse kidney.Western Blot (Tissue lysate)
RPIA MaxPab rabbit polyclonal antibody. Western Blot analysis of RPIA expression in human kidney.Western Blot (Cell lysate)
RPIA MaxPab rabbit polyclonal antibody. Western Blot analysis of RPIA expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of RPIA expression in transfected 293T cell line (H00022934-T03) by RPIA MaxPab polyclonal antibody.
Lane 1: RPIA transfected lysate(26.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RPIA
Entrez GeneID
22934GeneBank Accession#
BC015529.1Protein Accession#
ENSP00000283646Gene Name
RPIA
Gene Alias
RPI
Gene Description
ribose 5-phosphate isomerase A
Gene Ontology
HyperlinkOther Designations
ribose 5-phosphate epimerase|ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com