ICK purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ICK MaxPab rabbit polyclonal antibody. Western Blot analysis of ICK expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of ICK expression in transfected 293T cell line (H00022858-T02) by ICK MaxPab polyclonal antibody.
Lane 1: ICK transfected lysate(71.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ICK protein.
Immunogen
ICK (NP_055735.1, 1 a.a. ~ 632 a.a) full-length human protein.
Sequence
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ICK MaxPab rabbit polyclonal antibody. Western Blot analysis of ICK expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of ICK expression in transfected 293T cell line (H00022858-T02) by ICK MaxPab polyclonal antibody.
Lane 1: ICK transfected lysate(71.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ICK
Entrez GeneID
22858GeneBank Accession#
NM_014920.2Protein Accession#
NP_055735.1Gene Name
ICK
Gene Alias
KIAA0936, LCK2, MGC46090, MRK
Gene Description
intestinal cell (MAK-like) kinase
Gene Ontology
HyperlinkGene Summary
Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified. [provided by RefSeq
Other Designations
MAK-related kinase|OTTHUMP00000016630|OTTHUMP00000039961|intestinal cell kinase|serine/threonine protein kinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com