RRAS2 monoclonal antibody (M01), clone 2D3-4B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Western Blot analysis of RRAS2 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.
Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (48.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RRAS2.
Immunogen
RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Western Blot analysis of RRAS2 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8.
Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — RRAS2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Overexpression of wild type RRAS2, without oncogenic mutations, drives chronic lymphocytic leukemia.
Alejandro M Hortal, Clara L Oeste, Claudia Cifuentes, Miguel Alcoceba, Isabel Fernández-Pisonero, Laura Clavaín, Rut Tercero, Pilar Mendoza, Verónica Domínguez, Marta García-Flores, Belén Pintado, David Abia, Carmen García-Macías, Almudena Navarro-Bailón, Xosé R Bustelo, Marcos González, Balbino Alarcón.
Molecular cancer 2022 Feb; 21(1):35.
Application：WB-Ti, Mouse, Mouse leukemic cells.
-
R-Ras subfamily proteins elicit distinct physiologic effects and phosphoproteome alterations in neurofibromin-null MPNST cells.
Shannon M Weber, Nicole M Brossier, Amanda Prechtl, Stephen Barnes, Landon S Wilson, Stephanie N Brosius, Jody Fromm Longo, Steven L Carroll.
Cell Communication and Signaling 2021 Sep; 19(1):95.
Application：WB-Ce, WB-Tr, Human, 90-8, ST88-14, NMS2, NMS2-PC, S462, STS-26T, T265-2c, YST-1 cells.
-
High-efficiency unassisted transfection of platelets with naked double-stranded miRNAs modulates signal-activated translation and platelet function.
Sophia Lazar, Jeremy G T Wurtzel, Xi Chen, Peisong Ma, Lawrence E Goldfinger.
Platelets 2020 Aug; 1.
Application：WB-Tr, Human, Human platelets.
-
TC21/RRas2 regulates GPVI-FcRγ-mediated platelet activation and thrombus stability.
Janapati S, Wurtzel J, Dangelmaier C, Manne BK, Bhavanasi D, Kostyak JC, Kim S, Holinstat M, Kunapuli SP, Goldfinger LE.
Journal of Thrombosis and Haemostasis 2018 Jun; [Epub].
Application：WB-Ce, Human, Mouse, Platelets, PBMCs.
-
In vivo regulation of TGF-β by R-Ras2 revealed through loss of the RasGAP protein NF1.
Patmore DM, Welch S, Fulkerson PC, Wu J, Choi K, Eaves D, Kordich JJ, Collins MH, Cripe TP, Ratner N.
Cancer Research 2012 Oct; 72(20):5317.
Application：WB-Ti, Mouse, S462TY xenograft tumors.
-
Overexpression of wild type RRAS2, without oncogenic mutations, drives chronic lymphocytic leukemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com