PHB2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PHB2 full-length ORF ( AAH14766.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
58.63
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PHB2
Entrez GeneID
11331GeneBank Accession#
BC014766Protein Accession#
AAH14766.1Gene Name
PHB2
Gene Alias
BAP, BCAP37, Bap37, MGC117268, PNAS-141, REA, p22
Gene Description
prohibitin 2
Omim ID
610704Gene Ontology
HyperlinkOther Designations
B-cell associated protein|repressor of estrogen receptor activity
-
Interactome
-
Publication Reference
-
Small-molecule screening yields a compound that inhibits the cancer-associated transcription factor Hes1 via the PHB2 chaperone.
Perron A, Nishikawa Y, Iwata J, Shimojo H, Takaya J, Kobayashi K, Imayoshi I, Mbenza NM, Takenoya M, Kageyama R, Kodama Y, Uesugi M.
The Journal of Biological Chemistry 2018 May; 293(21):8285.
Application:WB, Human, HEK293 cells.
-
Identification and validation of new autoantibodies for the diagnosis of DCIS and node negative early-stage breast cancers.
Lacombe J, Mangé A, Jarlier M, Bascoul-Mollevi C, Rouanet P, Lamy PJ, Maudelonde T, Solassol J.
International Journal of Cancer 2013 Mar; 132(5):1105.
Application:ELISA, Human, Serum.
-
Small-molecule screening yields a compound that inhibits the cancer-associated transcription factor Hes1 via the PHB2 chaperone.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com