XAB1 monoclonal antibody (M01), clone 3E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
XAB1 monoclonal antibody (M01), clone 3E1 Western Blot analysis of XAB1 expression in HL-60 ( Cat # L014V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of XAB1 expression in transfected 293T cell line by XAB1 monoclonal antibody (M01), clone 3E1.
Lane 1: XAB1 transfected lysate(41.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to XAB1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XAB1 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to XAB1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant XAB1.
Immunogen
XAB1 (AAH07451, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
XAB1 monoclonal antibody (M01), clone 3E1 Western Blot analysis of XAB1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of XAB1 expression in transfected 293T cell line by XAB1 monoclonal antibody (M01), clone 3E1.
Lane 1: XAB1 transfected lysate(41.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to XAB1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XAB1 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to XAB1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GPN1
Entrez GeneID
11321GeneBank Accession#
BC007451Protein Accession#
AAH07451Gene Name
GPN1
Gene Alias
ATPBD1A, MBDIN, NTPBP, XAB1
Gene Description
GPN-loop GTPase 1
Omim ID
611479Gene Ontology
HyperlinkGene Summary
This gene encodes a guanosine triphosphatase enzyme. The encoded protein may play a role in DNA repair and may function in activation of transcription. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
MBD2 interactor protein|XPA binding protein 1, GTPase|putative ATP(GTP)-binding protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com