Product Browser

Last updated: 2014/12/14
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPN1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00011321-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human GPN1 protein.
  • Immunogen:
  • GPN1 (NP_009197.1, 1 a.a. ~ 374 a.a) full-length human protein.
  • Sequence:
  • MAASAAAAELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of GPN1 transfected lysate using anti-GPN1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GPN1 purified MaxPab mouse polyclonal antibody (B01P) (H00011321-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • GPN1
  • Gene Alias:
  • ATPBD1A,MBDIN,NTPBP,XAB1
  • Gene Description:
  • GPN-loop GTPase 1
  • Gene Summary:
  • This gene encodes a guanosine triphosphatase enzyme. The encoded protein may play a role in DNA repair and may function in activation of transcription. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • MBD2 interactor protein,XPA binding protein 1, GTPase,putative ATP(GTP)-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook